- Recombinant Inner membrane protein yidG (yidG)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1012155
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 13,768 Da
- E Coli or Yeast
- Inner membrane protein yidG (yidG)
- 1-120
Sequence
MPDSRKARRIADPGLQPERTSLAWFRTMLGYGALMALAIKHNWHQAGMLFWISIGILAIVALILWHYTRNRNLMDVTNSDFSQFHVVRDKFLISLAVLSLAILFAVTHIHQLIVFIERVA